Protein Info for SMc04458 in Sinorhizobium meliloti 1021

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 903 PF07517: SecA_DEAD" amino acids 9 to 390 (382 residues), 428.4 bits, see alignment E=4.2e-132 TIGR00963: preprotein translocase, SecA subunit" amino acids 30 to 810 (781 residues), 1098.8 bits, see alignment E=0 PF00270: DEAD" amino acids 97 to 220 (124 residues), 26.1 bits, see alignment E=1.9e-09 PF01043: SecA_PP_bind" amino acids 234 to 347 (114 residues), 138.5 bits, see alignment E=4.1e-44 PF21090: P-loop_SecA" amino acids 406 to 611 (206 residues), 306 bits, see alignment E=3.6e-95 PF07516: SecA_SW" amino acids 613 to 825 (213 residues), 230.5 bits, see alignment E=6.1e-72 PF02810: SEC-C" amino acids 882 to 899 (18 residues), 39.9 bits, see alignment (E = 9.1e-14)

Best Hits

Swiss-Prot: 82% identical to SECA_AGRFC: Protein translocase subunit SecA (secA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 82% identity to atu:Atu3520)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MI9 at UniProt or InterPro

Protein Sequence (903 amino acids)

>SMc04458 preprotein translocase subunit SecA (Sinorhizobium meliloti 1021)
MVSLGGFARKLFGSANDRRVRGYKGRVDAINALEAEMKALSDEALAAKTAEFRRELADGK
TLDDILVPAFAVVREAALRVLGLRPFDVQLIGGMILHERAIAEMKTGEGKTLVATLPVYL
NALAGKGVHVVTVNDYLAQRDAGMMGRIYGFLGMTTGVIVHGLSDEQRRDAYACDVTYAT
NNELGFDYLRDNMKYERGQMVQRGHFFAIVDEVDSILVDEARTPLIISGPLDDRSDLYNT
INEFIPLLSPEDYEIDEKQRSANFSEEGTEKLENMLREAGLLKGESLYDIENVAIVHHVN
NALKAHKLFTRDKDYIVRNGEIVIIDEFTGRMMPGRRYSEGQHQALEAKEKVQIQPENQT
LASITFQNYFRMYDKLAGMTGTAATEAEEFGNIYGLEVLEVPTNLPIKRIDEDDEVYRTV
GEKFKAIIDEIKSAHERGQPMLVGTTSIEKSELLADMLKKSGFSKFQVLNARYHEQEAYI
VAQAGVPGAVTIATNMAGRGTDIQLGGNPDMRIQQELADVEPGPEREAREKAIREEVQKL
KEKALAAGGLYVLATERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSDRMD
GMLQKLGLKEGEAIVHPWINKALERAQKKVEARNFDIRKNLLKYDDVLNDQRKVIFEQRI
ELMDAESVTDTVTDMRNEVIEEIVAKRIPERAYAEKWDAEGLKADVQQYFNLDLPIAEWV
AEEGIAEDDIRERITAAVDKAAAERAERFGPEIMQYVERSVVLQTLDHLWREHIVNLDHL
RSVIGFRGYAQRDPLQEYKSEAFELFQALLGNLRQAVTAQLMRVELVREAPEEPQPLPPM
QAHHIDPLTGEDDFAQAGETLLAVAPANRDPADPSTWGKVARNEACPCGSGKKYKHCHGI
YEA