Protein Info for SMc04452 in Sinorhizobium meliloti 1021

Annotation: NADH dehydrogenase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 372 to 399 (28 residues), see Phobius details PF00070: Pyr_redox" amino acids 6 to 40 (35 residues), 22.3 bits, see alignment 3.2e-08 amino acids 161 to 243 (83 residues), 38.6 bits, see alignment E=2.5e-13 PF07992: Pyr_redox_2" amino acids 6 to 323 (318 residues), 158.5 bits, see alignment E=5.4e-50

Best Hits

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 100% identity to sme:SMc04452)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NU3 at UniProt or InterPro

Protein Sequence (422 amino acids)

>SMc04452 NADH dehydrogenase transmembrane protein (Sinorhizobium meliloti 1021)
MQERHHVVVVGGGFGGLQLVNDLKGAPVKVTLIDRRNHHLFQPLLYQVATTVLATSEIAW
PIRRLYRDRQEVTTLLGEVAGVDMIAKEVTLAHGQSIPYDTLVLATGATHAYFGHDEWAA
VAPGLKTLEDATTIRRRVLIAFEQAEVEEDTARRDALLTFTIIGAGPTGVELAGIIAEMA
HRTLPGEFRRIDTRLARVVLVEAGPRILPAFSEELSAYASRELEKLGVEVLTGTPVTDCT
DEGVTIGESFVPSRTLVWAAGVQASPAARWVGADADRAGRVKVGPDLTAPHHPDIFVIGD
TASVIQEDGKPVPGIAPAAKQQGAYVAQVIRGRLTGSPAPGPFRYRHQGSLATIGKRAAI
IDFGRIKLRGSLAWWIWGIAHIYFLIGTRSRFAVAWSWLWTYLSGQHSARLITQKDTLRE
ER