Protein Info for SMc04446 in Sinorhizobium meliloti 1021

Annotation: histidine kinase sensory transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF13755: Sensor_TM1" amino acids 33 to 97 (65 residues), 106.3 bits, see alignment E=1.4e-34 PF13756: Stimulus_sens_1" amino acids 133 to 241 (109 residues), 133.3 bits, see alignment E=1.3e-42 PF00672: HAMP" amino acids 298 to 352 (55 residues), 32.7 bits, see alignment 1.9e-11 PF00512: HisKA" amino acids 360 to 423 (64 residues), 57.7 bits, see alignment E=2.5e-19 PF02518: HATPase_c" amino acids 477 to 591 (115 residues), 82.2 bits, see alignment E=9.3e-27

Best Hits

Swiss-Prot: 100% identical to CHVG_RHIME: Sensor protein ChvG (chvG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14980, two-component system, OmpR family, sensor histidine kinase ChvG [EC: 2.7.13.3] (inferred from 100% identity to sme:SMc04446)

Predicted SEED Role

"Sensor histidine kinase ChvG (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P72292 at UniProt or InterPro

Protein Sequence (595 amino acids)

>SMc04446 histidine kinase sensory transmembrane protein (Sinorhizobium meliloti 1021)
MVEVLQGDIEEAEGRASTLRGQRRWAHPFTLIRRLFGNAVFSSLTRRIVFFNLVALVVLV
GGIMYLNQFREGLIDARVESLLTQGEIIAGAISASASVDTNSITIDPEKLLELQAGESIT
PLPSDEDLEFPIIQERVAPVLRRLISPTRTRARLFDADADLLLDSRHLYSGGQVLRFDLP
PVDPESPSLADEFGTWFNRLLQPGDLPLYKEPPGGNGSIYPEVMNALTGVRGAVVRVTEK
GELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHAERLAIIRVFGVAALVNVILSLLLS
STIANPLRRLSAAAIRVRRGGAKEREEIPDFSSRQDEIGNLSVALREMTTALYDRIAAIE
NFAADVSHELKNPLTSLRSAVETLPLARNEESKKRLMDVIQHDVRRLDRLISDISDASRL
DAELARADAKKVDLEKLLGDLVEISRQIRGSKKPVLLDFVVDRKDNPRASFIVSGYELRI
GQIITNLIENARSFVPEQNGRIVVRLTRSRLRCIVYVEDNGPGIQAEDIDRIFERFYTDR
PEGEDFGQNSGLGLSISRQIAEAHGGTLRAENIAGKDGRISGARFVLSLPAGPHP