Protein Info for SMc04439 in Sinorhizobium meliloti 1021

Annotation: glycine betaine transport ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00005: ABC_tran" amino acids 4 to 142 (139 residues), 107.1 bits, see alignment E=5.9e-35 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 4 to 284 (281 residues), 340.2 bits, see alignment E=7.3e-106

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 100% identity to smk:Sinme_1938)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P28 at UniProt or InterPro

Protein Sequence (297 amino acids)

>SMc04439 glycine betaine transport ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MPGGCITVVMGLSGSGKSTLIRHINRLIDPTSGEVLYDGVDVCKMNENDLRAFRRHKTAM
VFQKFALLPHRTVLENTIYGLEIQGVDRRESEKRALGWIERVGLQGFEKHYPNQLSGGMQ
QRVGLARALTNDADILLMDEAYSALDPLIRVDMQSVLLELQKELKKTVVFITHDLDEALR
LGDKIAILRDGRVVQQGTGQEIVLSPADDYITAFVKEVNRGRVVNVETIMRPLSGNPEGL
PLAAGTVLEAAARTMTGAQISNAHVVDANGRPIGAIDLQMIISAMVTPVQHTDRQAA