Protein Info for SMc04411 in Sinorhizobium meliloti 1021

Annotation: membrane-bound lytic murein transglycosylase signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 36 to 240 (205 residues), 243.4 bits, E=1.5e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3308)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See Q92KY1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>SMc04411 membrane-bound lytic murein transglycosylase signal peptide protein (Sinorhizobium meliloti 1021)
MHRVKSAAAGLAALISTVVLPAAASAAQCGNDGSGFSAWLSEFKREAAGNGISPSVVDQA
LANVSYSRATIRADRGQKSFKLSLDQFMQKRGGQMIISRGKKLRAQNARLFQSIEQRYGV
PAGPLIAIWGMETGFGSFLGKEHTLSAVSTLAYDCRRSDYFTNQLYAALQLVERGDLSPA
ARGAAHGEIGQTQFLPVNVLKYGVDGDGNGHVDMVRSKADALASTANFLRGHGWQPGGGY
QPGEVNFAAIQGWNAASVYQQAIAIIGAEIDGG