Protein Info for SMc04410 in Sinorhizobium meliloti 1021

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR01296: aspartate-semialdehyde dehydrogenase" amino acids 4 to 333 (330 residues), 470.5 bits, see alignment E=1.5e-145 PF01118: Semialdhyde_dh" amino acids 4 to 118 (115 residues), 108.9 bits, see alignment E=2.2e-35 PF02774: Semialdhyde_dhC" amino acids 139 to 318 (180 residues), 180.7 bits, see alignment E=3.2e-57

Best Hits

Swiss-Prot: 54% identical to DHAS_RICFE: Aspartate-semialdehyde dehydrogenase (asd) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to smk:Sinme_3307)

MetaCyc: 44% identical to aspartate semialdehyde dehydrogenase (Arabidopsis thaliana col)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KY2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SMc04410 aspartate-semialdehyde dehydrogenase (Sinorhizobium meliloti 1021)
MGFKIAVAGATGNVGREMLNILSERGFPADEVVALASSRSVGTEVSYGDKTLKVTNLDTY
DFSDTDICLMSAGGAVSQKYSPKIGREGCVVIDNSSAWRYDADVPLIVPEVNADAIAQFS
KKNIIANPNCSTAQLVVALKPLHDHAKIKRIVVSTYQSVSGAGKDGMDELFNQTRAVFVA
DPIESKKFTKRIAFNVIPHIDVFMEDGYTKEEWKVLAETKKMLDPKIKVTCTAVRVPVFI
GHSESVNIEFENEITADEAREILREAPGCLVVDKHENGGYVTPYECAGEDATYISRIRED
ATVENGLNMWIVSDNLRKGAALNAVQIAELLINRGLIKPRKQAA