Protein Info for SMc04407 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 94 to 137 (44 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 528 to 554 (27 residues), see Phobius details amino acids 569 to 591 (23 residues), see Phobius details amino acids 597 to 617 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 235 (212 residues), 101.3 bits, see alignment E=6.3e-33 amino acids 515 to 628 (114 residues), 27.2 bits, see alignment E=1.9e-10 PF07690: MFS_1" amino acids 28 to 336 (309 residues), 92.2 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04407)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KY6 at UniProt or InterPro

Protein Sequence (629 amino acids)

>SMc04407 transport transmembrane protein (Sinorhizobium meliloti 1021)
MANVVTAGGTKAGPMTGEEKKVIFASSLGTVFEWYDFYLYGSLAVYIGATFFSQYPETTR
NIFALLAFAAGFLVRPFGALVFGRLGDLVGRKYTFLVTILIMGVSTFLVGVLPGAASIGI
AAPIILIALRLLQGLALGGEYGGAATYVAEHAPHGRRGYFTSWIQTTATLGLFLSLVVIL
LVQYMLGKEAFAEWGWRIPFLLSFVLLGVSVWIRLKMNESPAFKKMKEEGKGSKAPLTEA
FGQWRNAKIAVLALFGAVVGQAVVWYSGQFYALFFLQSILKVDGQSANLMVAASLLLGTG
FFVFFGWLSDKIGRKPIIMAGLLLAMLTYFPLFKALTWAGNPALAEAQQSVRATVTAAPG
DCKFQFNPTGTAKFTTSCDIATAFLTKNSVPYDVVTTAAAGTPATVKIGETTITSYDAIA
AGDRAKAEEAAFGKQINMALQASGYPLVRGAAKVPESKLDAFVAANPELGLDAAAVRAGE
KTMVPADKLVADKLLTQEEVGSATEMAVYNIDKGGAFTMVADPARVNWTVIIAVLTVLVI
YVTMVYGPIAALLVELFPTRIRYTGMSLPYHIGNGWFGGLLPATAFAMSAAKGDIYYGLW
YPIVFAGITLVIGLLFLPETKDRDIHTME