Protein Info for SMc04406 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01569: PAP2" amino acids 91 to 206 (116 residues), 99.8 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04406)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KY7 at UniProt or InterPro

Protein Sequence (235 amino acids)

>SMc04406 hypothetical protein (Sinorhizobium meliloti 1021)
MNRPLSLTVWIWLMTVVLVVAFTPFDPHLSEWAQGLPEEVVGFNRAITDIGTFAWMIYSS
ALLLLIAFVVRRSSARDTLRQRARAARNLSAYFLLTIGTASALVHGLKFLIGRARPELLA
DYGPYSLTPFTGDTLFESFPSGHSTAAGAFFGAFAMVMPQLRPLFLLLALLVGISRVVVG
AHYPSDVAAGLLLGLWVALMMAFVFARQGWLFNLGAAGWPVLRHVEHEAKERGAE