Protein Info for SMc04385 in Sinorhizobium meliloti 1021

Updated annotation (from data): L-2-aminoadipate semialdehyde dehydrogenase (EC 1.2.1.31)
Rationale: Specifically important for L-lysine utilization. This reaction is part of lysine catabolism via lysine 6-dehydrogenase (SMc02503), which forms (S)-2,3,4,5-tetrahydropyridine-2-carboxylate, which spontaenously interconverts with L-2-aminoadipate semialdehyde (also known as (S)-2-amino-6-oxohexanoate) in water.
Original annotation: aldehyde dehydrogenase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 50% identical to AL7A1_DICDI: Putative aldehyde dehydrogenase family 7 member A1 homolog (DDB_G0276821) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3282)

MetaCyc: 69% identical to L-aminoadipate-semialdehyde dehydrogenase (Pseudomonas putida)
L-aminoadipate-semialdehyde dehydrogenase. [EC: 1.2.1.31]

Predicted SEED Role

"Aldehyde dehydrogenase B (EC 1.2.1.22)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism (EC 1.2.1.22)

MetaCyc Pathways

methylglyoxal degradation V (3/3 steps found)
superpathway of methylglyoxal degradation (6/8 steps found)
L-lysine degradation VI (2/3 steps found)
methylglyoxal degradation IV (2/3 steps found)
L-lactaldehyde degradation (aerobic) (1/2 steps found)
L-lysine degradation IX (1/2 steps found)
L-lysine degradation VIII (1/2 steps found)
lactate biosynthesis (archaea) (3/5 steps found)
superpathway of fucose and rhamnose degradation (8/12 steps found)
L-lysine degradation V (5/9 steps found)
L-lysine degradation XI (2/5 steps found)
L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
L-rhamnose degradation II (3/8 steps found)
superpathway of L-lysine degradation (15/43 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.22

Use Curated BLAST to search for 1.2.1.22 or 1.2.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L07 at UniProt or InterPro

Protein Sequence (510 amino acids)

>SMc04385 L-2-aminoadipate semialdehyde dehydrogenase (EC 1.2.1.31) (Sinorhizobium meliloti 1021)
MNIAAKKIDVASEAAALLDKMGVAKDLYTGGDMPSFSPVTGEKIASLKTVSAAEAAGKIE
KADEAFRAWRLVPAPKRGELVRLLGEELRAFKADLGRLVSIEAGKIPSEGLGEVQEMIDI
CDFAVGLSRQLYGLTIATERPGHRMMETWHPLGVVGIISAFNFPVAVWSWNAALALVCGD
AVVWKPSEKTPLTALACQAILERAIARFGDAPEGLSQVLIGDRAIGEVLVDHPKVPLVSA
TGSTRMGREVGPRLAKRFARAILELGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTT
LRRLFVHESVYDQLVPRLKKAYQSVSVGNPLESAALVGPLVDKAAFDGMQKAIAEAKNHG
GAVTGGERVELGHENGYYVKPALVEMPKQEGPVLEETFAPILYVMKYSDFDAVLAEHNAV
AAGLSSSIFTRDMQESERFLAADGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSD
AWKAYMRRATNTVNYSKALPLAQGVSFDIE