Protein Info for SMc04362 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 378 (344 residues), 140.6 bits, see alignment E=6.1e-45 PF00083: Sugar_tr" amino acids 71 to 459 (389 residues), 176.5 bits, see alignment E=9.2e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04362)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NU5 at UniProt or InterPro

Protein Sequence (482 amino acids)

>SMc04362 transporter (Sinorhizobium meliloti 1021)
MVPTGGSSPVIRQLESAFTKIGVTGAHKQILALVLIGCLFDSFEQNTIGVAGPILKEHWG
LTGTDIGFLNTITFGSAAIGRLLSGILGDRYGRRVMLTINLLLFTIGSAACAMAPNFTML
CFARAIVGFGVGGEISTAVTMLSEFCSPKFRGTAAGLVNVGAGGFGNFLAPAFGLLIFTL
FPGENSWRWLFASLALPALLVVFYRRFVPETPRFLASKNKIGEANKVLSILASGSLKPRN
LVVHEYLTTDHMTDEAPEKSDWRELFRAPFIGRTIPVAIAILMSYGAQLSVLTLMPVIFV
SMGYTLSGSLLYSMIIQSGSVLGAIAASMFGYYLPRKKVLTVGAALACLAAVSIVTLGTN
IYLVLLFGAIFQFFVLLLNTSIWIYAPELFPTRIRAFGVALILATGSAAGSFVPTISGML
FDSYGMVGVFGLAAGMYAVFAFCIQLGPETYGRSMEDLSQPAEADQPKVAQQQGPVAVEL
RT