Protein Info for SMc04351 in Sinorhizobium meliloti 1021

Annotation: transmembrane ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 268 to 292 (25 residues), see Phobius details amino acids 524 to 549 (26 residues), see Phobius details amino acids 569 to 593 (25 residues), see Phobius details amino acids 612 to 630 (19 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 115.7 bits, see alignment E=5.1e-37 PF12704: MacB_PCD" amino acids 271 to 492 (222 residues), 155.9 bits, see alignment E=3.6e-49 PF02687: FtsX" amino acids 528 to 640 (113 residues), 75.1 bits, see alignment E=9.6e-25

Best Hits

Swiss-Prot: 100% identical to MACB_RHIME: Macrolide export ATP-binding/permease protein MacB (macB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to smk:Sinme_2048)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NU9 at UniProt or InterPro

Protein Sequence (647 amino acids)

>SMc04351 transmembrane ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MAPLISLQDVSKTYFNGDIAVEVLHHISLDIEAGEFVAIIGQSGSGKSTLMNILGCLDQP
TSGSYFIEGENVSGFDSDELAALRRRTFGFIFQSYNLIPTASARENVEVPAVYAGVSARD
RHDRAEALLQSLKLGERIDHRPNQLSGGQQQRVSIARALMNGGRVILADEPTGALDSQSG
DEVMRLLRDMNENGHTVIVITHSREVAAQADRLIEISDGHIVADRSKKRRSNRDAAVGLA
QRTREGFAAIADVSEAVKMALRALRANLFRTILTLLGIVIGVGSVVAMLAIGTGAQNSVL
DRISSMGSDLLVVRPSMANFRGSAGGTNVTLVPADADAITELANVAFAVPEMTSTVTLRR
GNIDYQTTANGTVPQFTEAKSWKIGRGEFINRNDMETYAPVAVLGETVVKTLFPEGSDPI
GQYVLVNKIPFQVIGVMSGMGASAGGNDQDDVVLVPLTTGSMRLFGQRNIRTITVKVQDA
SAIDLTQERIQALLNERHRKDDTQITNMSSVREAFTETSNTMKFFLGSVAAISLLVGGIG
VMNIMLVSVSERTREIGVRMATGARERDILVQFIVEALVVSAIGGAIGVVAGLSTGYAAK
AFGMPVSFTPGPVALAFACAFLTGLLFGYLPARNASRLQPAVALSAD