Protein Info for SMc04346 in Sinorhizobium meliloti 1021

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00670: AdoHcyase_NAD
  • amino acids 12 to 102 (91 residues), 27.5 bits, E=8e-10
• PF07991: IlvN
  • amino acids 14 to 178 (165 residues), 244.1 bits, E=1.4e-76
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 14 to 327 (314 residues), 424.4 bits, E=1.1e-131
• PF03807: F420_oxidored
  • amino acids 18 to 82 (65 residues), 25 bits, E=6.1e-09
• PF01450: IlvC
  • amino acids 184 to 327 (144 residues), 221.5 bits, E=1.3e-69

Best Hits

Swiss-Prot: 100% identical to ILVC_RHIME: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 100% identity to smk:Sinme_2045)

MetaCyc: 67% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

See Q52955 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SMc04346 ketol-acid reductoisomerase (Sinorhizobium meliloti 1021)
MRVYYDRDADLNLIKSKKVAIIGYGSQGRAHALNLKDSGAQNVAIALKSGSATAKKAEAD
GFKVMTVAEAAAWADLMMMATPDELQADIYKADIAGNIRDGAAIAFAHGLNVHFGLIEPK
ASVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAVHQDASGNALDLALSYACGVGGGRSGII
ETNFKEECETDLFGEQVVLCGGLVELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIY
EGGIANMNYSISNTAEWGEYVTGPRIITEDTKAEMKRVLKDIQTGKFTSEWMQEYRSGAA
RFKGIRRVNDSHQIEEVGAKLRAMMPWIGKNKLVDKAKN