Protein Info for SMc04302 in Sinorhizobium meliloti 1021

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 40 to 214 (175 residues), 220.9 bits, see alignment E=4.9e-70 PF02572: CobA_CobO_BtuR" amino acids 41 to 214 (174 residues), 223.4 bits, see alignment E=1.1e-70

Best Hits

Swiss-Prot: 90% identical to COBO_SINSX: Corrinoid adenosyltransferase (cobO) from Sinorhizobium sp.

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to sme:SMc04302)

MetaCyc: 90% identical to CobO (Pseudomonas denitrificans (nom. rej.))
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P37 at UniProt or InterPro

Protein Sequence (214 amino acids)

>SMc04302 cob(I)yrinic acid a,c-diamide adenosyltransferase (Sinorhizobium meliloti 1021)
MNDETANTGEPIAEKDEARHAMKMAKKKTARDKIMATKTDEKGLIIVHTGKGKGKSTAGF
GMIFRHIAHGMPCAVVQFIKGAMHTGERDLIEKHFGEICQFHTLGEGFTWETQDRARDIA
MAAKAWEKAKELIRDERNSMVLLDEINIALRYDYIDVAEVVSFLKEEKPHMTHVVLTGRN
AKEDLIEIADLVTEMELVKHPFRSGIKGQKGVEF