Protein Info for SMc04296 in Sinorhizobium meliloti 1021

Annotation: cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00065: cell division protein FtsZ" amino acids 10 to 330 (321 residues), 407 bits, see alignment E=4e-126 PF00091: Tubulin" amino acids 15 to 175 (161 residues), 171.5 bits, see alignment E=2.7e-54 PF12327: FtsZ_C" amino acids 224 to 319 (96 residues), 125.5 bits, see alignment E=8.8e-41

Best Hits

Swiss-Prot: 100% identical to FTSZ2_RHIME: Cell division protein FtsZ 2 (ftsZ2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to smk:Sinme_2027)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45484 at UniProt or InterPro

Protein Sequence (346 amino acids)

>SMc04296 cell division protein FtsZ (Sinorhizobium meliloti 1021)
MTEYKKPIITEMRPKITVIGVGGGGGNAINNMIAENLQGVDFIAANTDAQALATSKAERR
IQLGAAITEGLGAGSVPDIGNAAAQESIDEIMDHLGGTHMCFVTAGMGGGTGTGAAPVIA
EAARRAGILTVAVVTKPFSFEGQRRMQTAELGVERLRESADTVIVIPNQNLFRIADAKTT
FADAFMIADRVLYSGVSCITDLIVKEGLMNLDFADVKTVMKGMGRAMMGTGEATGENRAM
LAAEAAIANPLLDEVSMRGAKGVLVSISGGMDMTLFEVDEAATRIREEVYDEADIVVGAI
FDRSLDGTFRVSVVATGLDSNRSAQPTAPEAMNGQTAAAVPSRTLQ