Protein Info for SMc04263 in Sinorhizobium meliloti 1021

Annotation: amino acid carrier transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 440 (428 residues), 492.3 bits, see alignment E=5.9e-152 PF01235: Na_Ala_symp" amino acids 51 to 451 (401 residues), 528 bits, see alignment E=9.7e-163

Best Hits

Swiss-Prot: 46% identical to GLNT_BACSU: Probable sodium/glutamine symporter GlnT (glnT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to smk:Sinme_1904)

Predicted SEED Role

"amino acid carrier family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P60 at UniProt or InterPro

Protein Sequence (472 amino acids)

>SMc04263 amino acid carrier transmembrane protein (Sinorhizobium meliloti 1021)
MDTIIGFLNTIFWGYVLIYGLLAVGLYFTVRLGFPQIVHFSEMFRVLSRGGSKDAAGISP
FQALMVSLASRVGTGNLAGVAVALYLGGPGATFWMWIVAFVGMATAYAESALAQLYKIRN
EDGQYRGGPAFYIARGLNAPWAATIFSACLILSFGLVFNAVQANSIADAVQGAFGVPKLA
VGVAVALLSGVVIFGGIRQIARVAEIVVPFMAAAYLLTAVYVLIANASAVPGVLWTIISS
AFGFQEAAGGITGGIAAAMLNGVKRGLFSNEAGMGSAPNIAAVATPVPHHPSSQGFVQSL
GVFIDTILICTATSVMILLSGTLEPGSGVTGTQLTQAAMSTHIGSAGTYFIAIAIFFFAF
TSIIGNYSYAENALTYLGGGNRLGLMIMRCATLAMVVWGAYESITTVFDAADASMGLMAT
INLVAILLLSGTIAKLTKDYFEQRKAGAVPVFHAADYPELQGKIDGEIWSRD