Protein Info for SMc04220 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF12840: HTH_20" amino acids 29 to 77 (49 residues), 33.7 bits, see alignment E=5.5e-12 PF01022: HTH_5" amino acids 31 to 75 (45 residues), 50.2 bits, see alignment E=3.8e-17 PF01638: HxlR" amino acids 33 to 83 (51 residues), 22.7 bits, see alignment E=1.4e-08 PF12802: MarR_2" amino acids 41 to 80 (40 residues), 27.9 bits, see alignment E=4.3e-10

Best Hits

Swiss-Prot: 64% identical to BIGR_XYLFA: Biofilm growth-associated repressor (bigR) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1794)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P93 at UniProt or InterPro

Protein Sequence (105 amino acids)

>SMc04220 transcriptional regulator (Sinorhizobium meliloti 1021)
MGTVTKFRNIRPCMTERADEAAALLKAAANQNRLMILCTLIEGEHSVGQLEEMLGIRQPS
LSQQLTVLREAGIVATRRDAKQIFYRLAEEKAVRLVMALYQIFCR