Protein Info for SMc04213 in Sinorhizobium meliloti 1021

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 31 to 129 (99 residues), 77.5 bits, E=3.2e-26

Best Hits

Swiss-Prot: 100% identical to KDGL_RHIME: Diacylglycerol kinase (dgkA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 100% identity to sme:SMc04213)

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• phosphatidate metabolism, as a signaling molecule (1/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

See Q06119 at UniProt or InterPro

Protein Sequence (137 amino acids)

>SMc04213 diacylglycerol kinase (Sinorhizobium meliloti 1021)
MDAKNTTSRNGTAAPVHKHRGIRHLFAAASYSFGGAKRLIGEAAFRHELIAFAVAMVAFM
IVGANLFQYVAMAILFLLMMAFEAINTAIEEIVDRVSPEISEMGRNAKDLGSFACLCLIL
ANAAYALYVIFLARFLG