Protein Info for SMc04167 in Sinorhizobium meliloti 1021

Annotation: histidine-rich transporter transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 24 to 319 (296 residues), 231.2 bits, see alignment E=7.8e-73 PF01545: Cation_efflux" amino acids 29 to 245 (217 residues), 123.1 bits, see alignment E=6.7e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04167)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92P03 at UniProt or InterPro

Protein Sequence (321 amino acids)

>SMc04167 histidine-rich transporter transmembrane protein (Sinorhizobium meliloti 1021)
MSETHSPAPAGHDHVFLGDNHQRNERRTWFVIALTAGMMVAEIAAGTFYGSMALVADGWH
MSTHAAALLIAALAYLYARRNARNPRFTFGTGKLGDLAGFSSAIVLALIALLIGWESLLR
LANPVAISFPQAISVAVLGLAVNLACAWLLREDHSHHHHGHHHHGHHHHHEHHHSVSAHG
RDNNLRAAYLHVLADALTSVLAIVALAAGSVYGWIWLDPMMGIVGALVIARWSWGLIRDS
GSVLLDYIPPGEDLPDEIRAAIERDGDRITDLHVWQLGPGHHGAIVSLVTKNPQSPSTYR
RKLEHIHELSHVTVEVEPLAA