Protein Info for SMc04152 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF22290: DmmA-like_N" amino acids 5 to 129 (125 residues), 113.6 bits, see alignment E=8.2e-37 PF22289: DmmA-like_C" amino acids 140 to 183 (44 residues), 73 bits, see alignment 1.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3431)

MetaCyc: 53% identical to DmmA (Ruegeria pomeroyi DSS-3)
RXN-12901 [EC: 1.14.13.238]

Predicted SEED Role

"Mlr7321 protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.238

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KU6 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SMc04152 hypothetical protein (Sinorhizobium meliloti 1021)
MLVEGIKSRPVYTGLSIQPRARRHIFALEGEGAHALLDRKPALDETALSRSEILYVARGS
QGKGNDEALRALGADLFFAAPRIATLLFRLRGKLTTAHMGTRLYIAGTEGFIGQAMMVAL
DHGMDHASIITEHRGSLARRVQCVHCKGVTEDVTHSPFPCGHCGLPLLVRDHYSRRLGAF
QGVNIDAEEPGSAPDPEELFL