Protein Info for SMc04149 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 3 to 227 (225 residues), 41 bits, see alignment E=4e-14 PF00743: FMO-like" amino acids 3 to 225 (223 residues), 102.9 bits, see alignment E=4e-33 amino acids 244 to 377 (134 residues), 39.2 bits, see alignment E=8e-14 PF13738: Pyr_redox_3" amino acids 78 to 233 (156 residues), 44.4 bits, see alignment E=3.3e-15 PF13434: Lys_Orn_oxgnase" amino acids 113 to 222 (110 residues), 24.9 bits, see alignment E=2.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc04149)

MetaCyc: 59% identical to trimethylamine monooxygenase (Myroides profundi)
RXN-12900 [EC: 1.14.13.148]

Predicted SEED Role

"small molecule metabolism"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T77 at UniProt or InterPro

Protein Sequence (445 amino acids)

>SMc04149 oxidoreductase (Sinorhizobium meliloti 1021)
MTRVAVIGAGPSGLAQLRAFQSAAQKGAEIPEIVCYEKQSDWGGLWNYTWRTGLDEYGEP
VHGSMYRYLWSNGPKECLEFADYTFEEHFGKPIASYPPRAVLWDYIKGRVEKANVRDWVR
FNTPVRMVHFDEETKKFTVTAHNRLEDRMYDEEFDYVVVASGHFSTPHVPYFEGVKTFNG
RVLHAHDFRDALEFKGKDVLIVGRSYSAEDIGSQCWKYGAKSVTTSYRSKPMGFNWPENF
EERPLLTKLENKTAHFADGSTKEVDALILCTGYQHHFPFLPDELRLKTANRLWADHLYKG
VVFDKNPQLFYIGMQDQFYTFNMFDVQAWWARDVMMGRIALPPEEELKANFDMWRAREET
LEHAEEMIWYQGDYVKELLAETDYPSFDIEGVNRTFMKWEHHKAENIMGFRDNAYRSLMT
GNMSPKHHTPWVEALDDSLEEYLRA