Protein Info for SMc04145 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 4 to 168 (165 residues), 33 bits, E=1.2e-11
• PF01370: Epimerase
  • amino acids 6 to 177 (172 residues), 88.7 bits, E=1.5e-28
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 173 (168 residues), 58.6 bits, E=2.7e-19
• PF01073: 3Beta_HSD
  • amino acids 7 to 145 (139 residues), 41.3 bits, E=3.6e-14
• PF13460: NAD_binding_10
  • amino acids 9 to 114 (106 residues), 31.6 bits, E=5.1e-11
• PF07993: NAD_binding_4
  • amino acids 54 to 186 (133 residues), 31.5 bits, E=3.7e-11

Best Hits

Swiss-Prot: 56% identical to URODH_AGRFC: Uronate dehydrogenase (udh) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3438)

MetaCyc: 56% identical to D-uronate dehydrogenase moomer (Agrobacterium fabrum C58)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-glucuronate degradation III (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• D-galacturonate degradation III (1/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (4/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See Q92T73 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SMc04145 hypothetical protein (Sinorhizobium meliloti 1021)
MTTRLLITGAAGGLGRYAREGLKGCADVLRLSDVATLSPAGEGEEIVRCDLAEREAVDQL
VRGCDAILHLGAISVESDFDALLQANILGTYNLYEAARKAGVNRILFASTNHVTGFHPIG
ETLDHLSPRRPDSLYGVSKCFGEDLSRLYFDKYGMETACLRIGSCFAEPTNRRMLSTWLS
PRDFLALVRRLLDAPKIGHLVLYGVSANRDVWWSNGHADFLGWRPQDSSEPYRHEIEKRE
EEPSDGVRYQGGRHAAAKLPG