Protein Info for SMc04140 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 114.5 bits, see alignment E=9.3e-37 PF17912: OB_MalK" amino acids 236 to 288 (53 residues), 47.1 bits, see alignment 5.4e-16 PF08402: TOBE_2" amino acids 282 to 352 (71 residues), 37.8 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: K10111, maltose/maltodextrin transport system ATP-binding protein [EC: 3.6.3.19] (inferred from 100% identity to smk:Sinme_3443)

MetaCyc: 53% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19 or 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T68 at UniProt or InterPro

Protein Sequence (360 amino acids)

>SMc04140 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MATSVVLQKVEKRYGALDVIHGIDLTIDPGEFAVFVGPSGCGKSTLLRMIAGLEEISGGT
LMLDSDRMNEVAPARRGIAMVFQSYALYPHMSVYKNLAFGLETAGFKKAEIEPKVRRAAE
ILQIEKLLDRKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLSNLDAELRVQMRVEISRL
HRDLGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDLYNNPVNRFVAGFIGSPKM
NFLKARIADVTGSETAIEVCGGTIRLPRRLNGATQGQDVTFGIRPEHLSAREGGIELATV
NVEIVENLGGETMLYGITPDRQQLTVALEGQQKVERGSNLAVHFDPSRCHVFGADGRAMR