Protein Info for SMc04137 in Sinorhizobium meliloti 1021
Annotation: ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to YESQ_BACSU: Probable ABC transporter permease protein YesQ (yesQ) from Bacillus subtilis (strain 168)
KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_3446)Predicted SEED Role
"Nucleoside ABC transporter, permease protein 1"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92T65 at UniProt or InterPro
Protein Sequence (295 amino acids)
>SMc04137 ABC transporter permease (Sinorhizobium meliloti 1021) MTDATMSSVTAPPPVPTGRRGPVGSFLVHAALIAASIAMIYPLLWMISASVRPEDEIFAS TSLWPSSVDFSSYVRGWFGLDVSFGRFFWNSLVIAVLTVVGNVVACSLAAYAFARLRFAG RNFWFAIMLGTMMIPYHVTLIPQYVLFLDLGWVNTFLPLVVPKFLASDAFFIFLMVQFFR GIPRELDEAAMMDGCGAWRIYWKIMLPLSLPVLATAAIFSFIWTWDDFFGPLIYLNDMNS YTIQLGLRTFVDSSSTSDWGGLFAMSTLSLVPVFFFFLFFQRLLIEGIATTGMKR