Protein Info for SMc04136 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 303 (211 residues), 52.4 bits, see alignment E=2.9e-18

Best Hits

Swiss-Prot: 55% identical to YESP_BACSU: Probable ABC transporter permease protein YesP (yesP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc04136)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T64 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SMc04136 ABC transporter permease (Sinorhizobium meliloti 1021)
MQDTAVAVGTGASSRPAAQGRLARIWASHGAGYMFLLPWLIGFFGLTLGPAIASLYLSFT
NFDLIRAPEWIGTANYARIATADPKFAAAVKVTFLYVVLSVPFKLAFALLVAILLDRGVR
GLTVYRAIFYLPSLLGGSVAIAVLWRQLFAGDGLINSLLAQFGIEGPSWISHPDYSIWTL
VVLSVWQFGSPMIIFLAGLRQIPTDMYEAASLDGASKFRQFYKITLPLLTPVIFFNAVVQ
TIDAFKAFTPAFIISGGTGGPINSTLFYTLYLYQEAFGNFRMGYASALAWILVLIIGLFT
AFSFLTSRYWVHYDD