Protein Info for SMc04121 in Sinorhizobium meliloti 1021

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR01091: uracil phosphoribosyltransferase" amino acids 4 to 209 (206 residues), 276.2 bits, see alignment E=8.2e-87 PF14681: UPRTase" amino acids 7 to 208 (202 residues), 253.4 bits, see alignment E=1.5e-79 PF00156: Pribosyltran" amino acids 68 to 167 (100 residues), 31.3 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 100% identical to UPP_RHIME: Uracil phosphoribosyltransferase (upp) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to sme:SMc04121)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T49 at UniProt or InterPro

Protein Sequence (209 amino acids)

>SMc04121 uracil phosphoribosyltransferase (Sinorhizobium meliloti 1021)
MDGVTVIGHPLVQHKLTIMRKKETSTAGFRRLLKEISTLLCYEVTRDLELTTERIETPLV
ETDAPVLEGKKLVFASILRAGNGLLEGMLELVPSARVAHIGVYRDHETLQAVEYFFKAPD
NINERLVIVVDPMLATGNSAIAAIEKLKERGARNIRFLCLLAAPEGIRNFQGAHPDVPIF
TASIDSHLNEKGYIVPGLGDAGDRMYGTK