Protein Info for SMc04087 in Sinorhizobium meliloti 1021

Annotation: transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 324 to 351 (28 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 406 to 430 (25 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 421 (390 residues), 53.1 bits, see alignment E=2.5e-18 PF11700: ATG22" amino acids 61 to 455 (395 residues), 122.9 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: K06902, MFS transporter, UMF1 family (inferred from 100% identity to smk:Sinme_3312)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KX7 at UniProt or InterPro

Protein Sequence (463 amino acids)

>SMc04087 transmembrane protein (Sinorhizobium meliloti 1021)
MDIAAGRMEERPRTSRLGIAGWMLFDWAAQPFFTVITTFIFAPYFVSRLTADPAHGQAVW
GYTLTVAGIVIALLSPVLGAIADASGPRKPWIAFFAAVKIISLALLWNAAPGSSLIYTAL
LLALATVAAEFSIVFNDSMMTRLVSEKEVGRISNIAWGLGYLGGMIVLIAVVALIAGSPQ
TGKTAIGLEPLFGLDPAKGEDARITGPISAAWYLVFILPMFLFTPDATRARMSMAKATAR
GFEELKGTLAELKERAGILRFLIARMIFQDGVNGLLALGGTFAAGMFGWQTMELGLYGII
LNVVAIFGCLYASRLDARLGSKTIVVASLVSLTIATLGIVSTGPGFTLFGLVPLGSTDSG
GLFGTAAEKAYILYGLLVGVAFGPVQASSRSYLARSVSPDEAGRYFGLYALSGRATSFLA
PASVATITLVTGSARIGMMALVAFLAVGLVILLRTPYPAHRPL