Protein Info for SMc04051 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase sigma-E factor (sigma-24) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF04542: Sigma70_r2" amino acids 14 to 79 (66 residues), 39.4 bits, see alignment E=6.5e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 162 (146 residues), 66.2 bits, see alignment E=1.4e-22 PF08281: Sigma70_r4_2" amino acids 107 to 158 (52 residues), 41.3 bits, see alignment E=1.5e-14 PF04545: Sigma70_r4" amino acids 112 to 158 (47 residues), 32.5 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to smk:Sinme_2888)

Predicted SEED Role

"macromolecule metabolism; macromolecule synthesis, modification; rna synthesis, modification , dna transcription"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M23 at UniProt or InterPro

Protein Sequence (178 amino acids)

>SMc04051 RNA polymerase sigma-E factor (sigma-24) protein (Sinorhizobium meliloti 1021)
MSGIMRSRVERRLEPHYARLFAYAVALSRDRDGAQDIFQECIARALDARSVPETEPAFRA
WLFAILRNIWIDQSRLRRRRSDLEQEFVTDLVPAPVAPETVLVDAFSVRQAFTRLSTEHR
EILALVDISGFSYEEVAMMIAVPKGTVMSRVSRARRALASYLGDANVVELARHREGRK