Protein Info for SMc04034 in Sinorhizobium meliloti 1021

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 4 to 78 (75 residues), 50 bits, see alignment E=3.2e-17 PF00528: BPD_transp_1" amino acids 115 to 311 (197 residues), 138.3 bits, see alignment E=2.6e-44

Best Hits

Swiss-Prot: 35% identical to GSIC_ECOL6: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_2872)

MetaCyc: 35% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M39 at UniProt or InterPro

Protein Sequence (312 amino acids)

>SMc04034 peptide ABC transporter permease (Sinorhizobium meliloti 1021)
MHRYRFVLTRPLQFLPVIFGISIITFILVRLIPGDPARNLLGARATPSAIAKIRAQYGLD
EPMWQQYFYFLKNLADGEMGKSILYKIDVLKLIATRVEPTIALVLSSVVLAVLIAVPMAA
LAARNSGKAPDHIVRVVSTFGIGFPPFWLGLMLMILFSVKLDVLPVSGYGATFGDKLAHL
ILPSLTVALSLSTVLVRSLRAAMIESLKSDVATAARARGMPERIVFWRHVVPNSLVPTIN
LLAVNIGWLIGGTVVVESVFALPGMGQLLVRAIFSRDYMVVQGVAMVFACATVLVNFIAD
IVTVAVDPRVKL