Protein Info for SMc04026 in Sinorhizobium meliloti 1021

Annotation: glutamate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01317: glutamate synthase, NADH/NADPH, small subunit
  • amino acids 3 to 484 (482 residues), 617.5 bits, E=9.1e-190
• PF14691: Fer4_20
  • amino acids 24 to 133 (110 residues), 90.2 bits, E=4.5e-29
• PF07992: Pyr_redox_2
  • amino acids 146 to 466 (321 residues), 90.3 bits, E=8.4e-29
• PF01494: FAD_binding_3
  • amino acids 147 to 180 (34 residues), 25.3 bits, see alignment (E = 5e-09)
• PF03486: HI0933_like
  • amino acids 147 to 181 (35 residues), 26.8 bits, 1.2e-09
• PF00070: Pyr_redox
  • amino acids 147 to 181 (35 residues), 24.1 bits, 2.4e-08
• PF12831: FAD_oxidored
  • amino acids 148 to 187 (40 residues), 28.1 bits, 7.7e-10
• PF00890: FAD_binding_2
  • amino acids 148 to 182 (35 residues), 25.4 bits, 4.6e-09
• PF13450: NAD_binding_8
  • amino acids 150 to 184 (35 residues), 37.8 bits, 1.1e-12
• PF01593: Amino_oxidase
  • amino acids 156 to 185 (30 residues), 26.2 bits, see alignment (E = 2.8e-09)

Best Hits

Swiss-Prot: 50% identical to GLTD_MYCTO: Glutamate synthase [NADPH] small chain (gltD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to smk:Sinme_2865)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See Q92M46 at UniProt or InterPro

Protein Sequence (485 amino acids)

>SMc04026 glutamate synthase (Sinorhizobium meliloti 1021)
MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMSDQEVQKQSARCMDCGIPYCHGPTGC
PVHNQIPDWNDLVYNGNWDEAIRNLHSTNNFPEFTGRVCPAPCEEACTLNLEDVPVAIKT
IEQAIADKAYEMGYIVPQPAVTKTGKKVAVIGSGPAGMAAAQQLARAGHEVHVYERESKP
GGLLRYGIPDFKMEKNFIDRRVEQMRGEGVTFHCGVNVGVDVAVQKLVDENDAVLYCGGS
ETPRDAGIPGVEFFGVHDAMPYLVQQNRRVGRENIDSVGWPSEPILAGGKHVVVVGGGDT
ASDCVGTAFRQGAVKVTQLDIRPQPPEKEDKLAVWPFWATKMRTSSSQAEGAVREFQVAT
LEFVGDEDGNLTGVKCCQVDERRKPIAGTEFIIKADLAFIAIGFRGPFADSVLKDLGEKL
TVNTDRRGSTNVVANERDYRTSVDKLWAAGDIRRGQSLVVWAIREGRQAARAIDEALMGS
TVLPR