Protein Info for SMc04024 in Sinorhizobium meliloti 1021

Annotation: membrane-bound lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13406: SLT_2" amino acids 33 to 327 (295 residues), 344.5 bits, see alignment E=7.5e-107 TIGR02283: lytic murein transglycosylase" amino acids 33 to 331 (299 residues), 352.7 bits, see alignment E=8.3e-110 PF01471: PG_binding_1" amino acids 353 to 403 (51 residues), 58.6 bits, see alignment 8.5e-20

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to sme:SMc04024)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M47 at UniProt or InterPro

Protein Sequence (405 amino acids)

>SMc04024 membrane-bound lytic murein transglycosylase (Sinorhizobium meliloti 1021)
MMRNRRTFFRHIAAALVVAAAFGSSPARADQGFQNWINNFYATAAKNGISQATYRKAFAG
VKTPDPAVLEKAAYQPEFKHKIWEYVDARVNPYTKRIGQEMAAKHARTLNALERHYGVDK
SILLAIWSMESNYGAILQKDDRLHYVPRALATLAYADSRRSKFAKTQLIAALKILQSGDI
TPRELTGSWAGAMGHTQFIPTSYLLYAVDADGNGHRDIWNSVPDALATAANLLRKNGWRP
GETWGYEVVPPANGAKYSGQTKTLGQWAALGFARPGGKGFSNPKMRAELKLPGGGNGPGF
LMTKNFFVIKRYNASDSYALGVGLLADQIAGYAGMQQRWPRPDGSLDISEKFELQNRLKE
LGYYDGEVDGNFGSGSKAAIQAFQNQNGLAPDGEPTQHLLRALRR