Protein Info for SMc04020 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF01145: Band_7" amino acids 24 to 194 (171 residues), 138 bits, see alignment E=1.7e-44

Best Hits

Swiss-Prot: 65% identical to QMCA_ECOLI: Protein QmcA (qmcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2859)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M51 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SMc04020 hypothetical protein (Sinorhizobium meliloti 1021)
MGGMDIAVVAFVVVVILVLFAGIKTVPQGYRYTVERFGRYTRTMEPGLNLIVPFIDRIGS
KLSVMEQVLDVPTQEVITKDNASVSADAVAFYQVLNAAQAAYQVANLENALLNLTMTNIR
SVMGSMDLDELLSNRDTINDRLLHVVDEAANPWGIKITRIEIKDIAPPKDLVDAMARQMK
AEREKRAQVLEAEGSRNAQILRAEGAKQSAILQAEGQREAAYREAEARERLAEAEAKATR
MVSEAIAAGDVQAINYFVAQKYTEALAAIGTANNQKIVLMPMEASSLIGSLGGIGAIAKE
VFGEGTASSPRQRQSTPRTGPSVPSETP