Protein Info for SMc03996 in Sinorhizobium meliloti 1021

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF02581: TMP-TENI" amino acids 10 to 188 (179 residues), 137 bits, see alignment E=2.4e-44

Best Hits

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to sme:SMc03996)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M70 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SMc03996 thiamine-phosphate pyrophosphorylase (Sinorhizobium meliloti 1021)
MSNIEDRCRLVLVVPDIADSAERARLVGEALKGGDVASVIVPQYALSDADFQKHAEALVP
VIQQAGAAALIEGDTRVAGRAKADGLHIAGGPDALADAIERHAPKLIVGGGNATDRHHAL
EIGELRPDYVFFGRTDGDIKPEAHPKNLALAEWWASMIEIPCIVMGGTDPQSALAVAETG
AEFVALRLAVFGEAGQAPSVVAAVNALLDEKAPRFEG