Protein Info for SMc03991 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 13 to 587 (575 residues), 942.8 bits, see alignment E=3.8e-288 PF00664: ABC_membrane" amino acids 35 to 297 (263 residues), 180 bits, see alignment E=1.2e-56 PF00005: ABC_tran" amino acids 367 to 516 (150 residues), 117.9 bits, see alignment E=8e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2830)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M72 at UniProt or InterPro

Protein Sequence (604 amino acids)

>SMc03991 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MPRQEKQTPARRSIRPLATVLPYLSRYRGLAIGAAVSLTIAAATTLTLPLAVRRMIDHGF
SNSDSGFINTYFSMLMVLAVVLALASAARYYFVISLGERIVADLRRDVFARVMQLSASFF
DVNQSGEIVSRLTADATQIKSAVGATASVALRNLILCLGAMGMMVYTSPKLSSLVLAAIP
LIVFPLVGFGRSVRRRSREAQDMLAAASAYAGEAIAATRTVQAFNGEESARSRYGSAVEA
AYRAARAATRARSVLTAFAITMVFGSVVAVLWFGARDVLADSLSAGTLGQFLLYSVFAAG
SLGALSEVWGELSQAAGAAERLNELLNEVPEIEAPEHPVAMPVPATGAVEFENVHFAYPA
RPDYKSLRGLSFAVRPGETVAIVGPSGAGKSTVFSMLLRYYDPAKGTIRVDGTDVRAVDP
EELRERLAIVPQDVTIFATSVHDNIAFGVPDASREAVRAAAVAAQADEFIGRLDRGYDTL
VGERGVTLSGGQRQRIAIARAILKNAPILLLDEATSALDAESETLVQKALDVLMQERTTL
VIAHRLATVLKADRILVMEHGRIVEEGTHESLIRQGGLYAKLARLQFDHGAEALFVASPA
PISP