Protein Info for SMc03971 in Sinorhizobium meliloti 1021

Annotation: multidrug-efflux system transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1058 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details amino acids 440 to 462 (23 residues), see Phobius details amino acids 469 to 498 (30 residues), see Phobius details amino acids 547 to 567 (21 residues), see Phobius details amino acids 882 to 900 (19 residues), see Phobius details amino acids 906 to 929 (24 residues), see Phobius details amino acids 937 to 960 (24 residues), see Phobius details amino acids 984 to 1004 (21 residues), see Phobius details amino acids 1015 to 1038 (24 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 3 to 1043 (1041 residues), 1198.3 bits, see alignment E=0 PF00873: ACR_tran" amino acids 4 to 1039 (1036 residues), 1137.8 bits, see alignment E=0 PF03176: MMPL" amino acids 346 to 500 (155 residues), 35.5 bits, see alignment E=8.7e-13 amino acids 831 to 1037 (207 residues), 25.4 bits, see alignment E=1e-09 PF02355: SecD_SecF_C" amino acids 350 to 497 (148 residues), 20.9 bits, see alignment E=3.2e-08

Best Hits

KEGG orthology group: None (inferred from 80% identity to ara:Arad_4655)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M87 at UniProt or InterPro

Protein Sequence (1058 amino acids)

>SMc03971 multidrug-efflux system transmembrane protein (Sinorhizobium meliloti 1021)
MRFAHFFVDRPIFASVLSIVLLIVGSIAYFQLPVAQYPEIAPPTIVVRASYPGADAETVA
NTVATPLEQEINGVENMLYMSSYATADGSMALTITFKLGTDLDQAQVLVQNRVSIAEPRL
PEEVRRIGVTTTKSSPDLMMVVHLLSPNDRYDQLYVSNYARTRIRDILVRLDGVGDVLLF
GEREYALRIWLDPQKLSAYGMTAGDVVSALREQNVQVSGGSIGGPPMSSDSAFQYTVTTD
GRFSDARQFRYVIVKATEEGRLVQLQDVARIELGAREYVTNSYLNGSPAVALGIFSRPGS
NALAAADAIQATMTELSRDFPEGLEYRIIYNPTEFISESIDEVYKTIAEAALLVALVVIV
FLQSWRTAIIPIVAIPVSLVGTFALLYAFGFSLNMLTLFGLVLAIGIVVDDAIVVVENVE
RNLARGMTPREAAHVTMDEVGAAVIAISLVLTAVFVPTAFIPGIAGQFYLQFAVTIAVAT
VISAVNSLTLSPALAAILLRPHENHDHESRNPLTRLGRGFANGFNRGFDRMADGYAWTVR
HLVRTRIALAGALLVFVALLGATWYMAQVVPRGFIPTMDQGYAIVVIQLPDGASLERTDK
VVRRASEMIREVPGVKDAVAFAGFNGATFTNASNSGVIFTPFDSFEERLEQKQSAEQIIG
QIFGAMQGIQEAFIIAVPPPSVRGIGNSGGFKMQIMDRQSADMRRALGLAYQMMGAANQT
EGLTGVFTTFTASSPQFFLAIDRDKARALNVPIPNIFETLSINLGTSYVNDFNAFGRVYQ
VRAQADQQFRLEREDILALKVRSASGALVPLGTLVEIRDTSGPALVQRYNMYVSVPVQGN
PAPGVSTGSALDKMEALAGQILPQGTTFEWTELALQERQTGNTAVFIFALSVVFVFLALS
AQYESWVLPLAIILIVPLAVLAALLGVSIRGFDNNVLTQIGLIVLIGLAAKNAILIVEFA
RQGEEEGKTPIEAAIDASRLRLRPILMTAFAFILGVVPLVIATGPGAEMRQSLGTAVFAG
MLGVTFLGLFLTPVFYVALRSLRRKPAPAAVPAPAPGE