Protein Info for SMc03967 in Sinorhizobium meliloti 1021

Annotation: Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00228: crossover junction endodeoxyribonuclease RuvC
  • amino acids 7 to 159 (153 residues), 142.3 bits, E=5.9e-46
• PF02075: RuvC
  • amino acids 7 to 154 (148 residues), 153.8 bits, E=1.6e-49

Best Hits

Swiss-Prot: 100% identical to RUVC_RHIME: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 98% identity to rhi:NGR_c27930)

MetaCyc: 44% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

See Q92M90 at UniProt or InterPro

Protein Sequence (170 amino acids)

>SMc03967 Holliday junction resolvase (Sinorhizobium meliloti 1021)
MQNTIRIIGIDPGLRRTGWGVIETLGNSLRFVASGTVTSDGELDLASRLCQLHDGLAEVV
HGYQPHEAAVEQTFVNKDATATLKLGQARGIAMLVPARAGLRVAEYAPNAVKKAVIGVGH
GEKQQIHMMLKVLMPKAEFKGNDAADALAIAICHAHNRQAVTSRLAALAG