Protein Info for SMc03935 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF07719: TPR_2" amino acids 78 to 110 (33 residues), 24.5 bits, see alignment 1.3e-08 amino acids 180 to 212 (33 residues), 28.3 bits, see alignment 8e-10 amino acids 248 to 281 (34 residues), 28.3 bits, see alignment 8e-10 PF13181: TPR_8" amino acids 79 to 110 (32 residues), 18 bits, see alignment 1.6e-06 amino acids 112 to 145 (34 residues), 22.1 bits, see alignment 7.7e-08 amino acids 148 to 177 (30 residues), 19.3 bits, see alignment (E = 6.1e-07) amino acids 181 to 212 (32 residues), 27.3 bits, see alignment 1.7e-09 amino acids 248 to 281 (34 residues), 24.4 bits, see alignment 1.5e-08 PF00515: TPR_1" amino acids 79 to 111 (33 residues), 27.9 bits, see alignment 9.5e-10 amino acids 113 to 145 (33 residues), 27.9 bits, see alignment 9.8e-10 amino acids 180 to 212 (33 residues), 35.6 bits, see alignment 3.8e-12 PF13432: TPR_16" amino acids 84 to 145 (62 residues), 32.6 bits, see alignment E=6e-11 amino acids 152 to 214 (63 residues), 22.1 bits, see alignment E=1.2e-07 amino acids 186 to 240 (55 residues), 18.7 bits, see alignment E=1.3e-06 amino acids 220 to 280 (61 residues), 18.6 bits, see alignment E=1.5e-06 PF13431: TPR_17" amino acids 101 to 132 (32 residues), 23.2 bits, see alignment 3.6e-08 amino acids 169 to 201 (33 residues), 23.6 bits, see alignment 2.8e-08 PF13414: TPR_11" amino acids 153 to 191 (39 residues), 39.4 bits, see alignment 2.6e-13 amino acids 189 to 228 (40 residues), 33.7 bits, see alignment 1.5e-11 PF13174: TPR_6" amino acids 182 to 213 (32 residues), 14.3 bits, see alignment 3.5e-05

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2911)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92M02 at UniProt or InterPro

Protein Sequence (295 amino acids)

>SMc03935 hypothetical protein (Sinorhizobium meliloti 1021)
MTLAAMTADVSGLITEEANRRHQRKPKLAAFLVLGSALLIAGCQTDKPESMFRVERAQGS
EENIASLSSVIASNPSDPEGYNVRGSAYGRAGEFRRAVADFDQAIQLNPRFYQAYANRAL
VQRNLGNQQAALADYNAALQINPNYDVAYIGRGNLYRQANQLDAAFNDFNKAIELDTADP
RAYHNRGLIYQARNQHAQAIEDFSKAISLSPSSPEPYNGRGISYVAQGDDDNAFSDFNTA
INLNGKLAESWANQALIYERRGDKAKAAKSYSHALSLDPKYEPARAGLARAKAMS