Protein Info for SMc03930 in Sinorhizobium meliloti 1021

Annotation: sarcosine oxidase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01375: sarcosine oxidase, gamma subunit family
  • amino acids 36 to 181 (146 residues), 195.9 bits, E=1.7e-62
• PF04268: SoxG
  • amino acids 44 to 176 (133 residues), 51.3 bits, E=7.1e-18

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 100% identity to sme:SMc03930)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

• glycine betaine degradation I (7/8 steps found)
• creatinine degradation I (2/4 steps found)
• creatinine degradation II (1/5 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See Q92M07 at UniProt or InterPro

Protein Sequence (184 amino acids)

>SMc03930 sarcosine oxidase subunit gamma (Sinorhizobium meliloti 1021)
MADQAIATRKAPLAGRRGGSPAAILTPAEPASRVSLRAGADAVPALSAALGVTIPVRPKT
SASTGRRHVLWLGPDEWLVIDEDGADLMAAAASSGTVHAAVDVSHRNTAVIVSGPGAEAA
INSGCPQDLSLSIFPVGACSRTIFGKAEIVLFRTAEDTFRVECWRSFSPFVFGLLAEGAE
EAGH