Protein Info for SMc03900 in Sinorhizobium meliloti 1021

Annotation: cyclic beta-1,2-glucan ABc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 transmembrane" amino acids 50 to 74 (25 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 168 to 204 (37 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details TIGR01192: glucan exporter ATP-binding protein" amino acids 32 to 616 (585 residues), 1181.2 bits, see alignment E=0 PF00664: ABC_membrane" amino acids 53 to 319 (267 residues), 162.4 bits, see alignment E=1.9e-51 PF00005: ABC_tran" amino acids 383 to 531 (149 residues), 118.6 bits, see alignment E=3.3e-38

Best Hits

Swiss-Prot: 100% identical to NDVA_RHIME: Beta-(1-->2)glucan export ATP-binding/permease protein NdvA (ndvA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to sme:SMc03900)

Predicted SEED Role

"Beta-(1-->2)glucan export ATP-binding/permease protein NdvA (EC 3.6.3.42)" (EC 3.6.3.42)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18767 at UniProt or InterPro

Protein Sequence (616 amino acids)

>SMc03900 cyclic beta-1,2-glucan ABc transporter (Sinorhizobium meliloti 1021)
MKIILAVGSRRNALPHRAVAAPIPIPERGETVSLFQVYARALQYLAVHKFRVGAIVIANI
VLAAITIAEPILFGRIIDAISSQKDVAPMLLLWAGFGVFNTIAFVLVSREADRLAHGRRA
SLLTEAFGRIVSMPLSWHSQRGTSNALHTLLRACETLFGLWLEFMRQHLATAVALMLLIP
TAFAMDVRLSLILVVLGAAYVMISKVVMSRTKEGQAAVEGHYHTVFSHVSDSISNVSVVH
SYNRIEAETRELKKFTQRLLSAQYPVLDWWALASGLNRIASTISMMAILVIGTVLVQRGE
LGVGEVIAFIGFANLLIGRLDQMKAFATQIFEARAKLEDFFQLEDSVQDREEPADAGELK
GVVGEVEFRDISFDFANSAQGVRNVSFKAKAGQTIAIVGPTGAGKTTLVNLLQRVHEPKH
GQILIDGVDIATVTRKSLRRSIATVFQDAGLMNRSIGENIRLGREDASLDEVMAAAEAAA
ASDFIEDRLNGYDTVVGERGNRLSGGERQRVAIARAILKNAPILVLDEATSALDVETEAR
VKDAIDALRKDRTTFIIAHRLSTVREADLVIFMDQGRVVEMGGFHELSQSNGRFAALLRA
SGILTDEDVRKSLTAA