Protein Info for SMc03876 in Sinorhizobium meliloti 1021

Annotation: HEAT shock-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF01479: S4" amino acids 13 to 59 (47 residues), 54.3 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to sme:SMc03876)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L27 at UniProt or InterPro

Protein Sequence (143 amino acids)

>SMc03876 HEAT shock-like protein (Sinorhizobium meliloti 1021)
MEKQPPSAPAMRQRLDKWLFFARLIKSRSLAQKAIEAGHVAVNGKRETQSSAQIKAGDML
EVSLERRDLVVRVLLPGSRRGPYEEARLLYEDLTPAVPAGRPTLFEQATRDRGAGRPTKR
DRRETDRLRPGPDRLRPGDLEDD