Protein Info for SMc03875 in Sinorhizobium meliloti 1021

Annotation: ferredoxin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF12838: Fer4_7" amino acids 8 to 54 (47 residues), 27.2 bits, see alignment E=1.8e-09 PF00037: Fer4" amino acids 34 to 56 (23 residues), 31.1 bits, see alignment 6e-11 PF11953: DUF3470" amino acids 65 to 105 (41 residues), 68.8 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 73% identical to FER2_RHOCB: Ferredoxin-2 (fdxA) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K05524, ferredoxin (inferred from 100% identity to sme:SMc03875)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L28 at UniProt or InterPro

Protein Sequence (112 amino acids)

>SMc03875 ferredoxin protein (Sinorhizobium meliloti 1021)
MTYVVTDNCIRCKYTDCVEVCPVDCFYEGENFLVIHPDECIDCGVCEPECPAGAIKPDTE
PGLDMWLKLNAEFSTQWPNITVKRDPLPEAKEMDGVEEKYEKYFSSEPGQGD