Protein Info for SMc03873 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase factor sigma-32

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 39 to 276 (238 residues), 104.9 bits, see alignment E=1.7e-34 PF04542: Sigma70_r2" amino acids 46 to 112 (67 residues), 61.6 bits, see alignment E=4.9e-21 PF04545: Sigma70_r4" amino acids 223 to 274 (52 residues), 60.6 bits, see alignment 8.4e-21

Best Hits

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to smk:Sinme_3253)

Predicted SEED Role

"RNA polymerase sigma factor RpoH-related protein" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G3XCP8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>SMc03873 RNA polymerase factor sigma-32 (Sinorhizobium meliloti 1021)
MKTLTADRRMIKIAMEAPYLERDEEHALAQAWRNDNDQEARNKIAMSHMRLVISMAAKFR
SFGLPMGDLVQEGHIGLLEAAARFEPSREVRFSTYATWWIRASMQDYVLRNWSIVRGGTS
SAQKALFFNLRRLRARLAQGDRQLTSQAMHEEIAAALGVSLADVQTMDARLSGNDASLQA
PIGSGDPDAGARLDFLASEAPLPDEQVSDLIDGERARRWLQVALGELSEREMKIIRARRL
TEDGATLEELGVALGISKERVRQIETRALEKLRAALTAKAPALTASMH