Protein Info for SMc03867 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01378: thiamine pyrophosphokinase" amino acids 7 to 206 (200 residues), 146.7 bits, see alignment E=3.2e-47 PF04263: TPK_catalytic" amino acids 29 to 126 (98 residues), 63.8 bits, see alignment E=1.4e-21 PF04265: TPK_B1_binding" amino acids 150 to 202 (53 residues), 30.8 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: K00949, thiamine pyrophosphokinase [EC: 2.7.6.2] (inferred from 100% identity to smk:Sinme_3247)

Predicted SEED Role

"Thiamin pyrophosphokinase (EC 2.7.6.2)" in subsystem PnuC-like transporters or Thiamin biosynthesis (EC 2.7.6.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L35 at UniProt or InterPro

Protein Sequence (216 amino acids)

>SMc03867 hypothetical protein (Sinorhizobium meliloti 1021)
MTRSPFTILLGGALTPTDRLARQLEGSRFVAADGGMRHARTLGVVPDLWVGDFDSTDEAL
LAEFAGVPRERHPAAKNATDGEIAVEAALERGATSLVFAGGLGGARSDHAFLHLLGTVAL
AESGVAVMMTSGEEEAYPLLPGSQEIELPKGSLFSILGFADLDGLSIENVRYPLKDFHLP
FGSSRTISNIADGTVRFTLKSGRAVILARPYDLSGA