Protein Info for SMc03864 in Sinorhizobium meliloti 1021

Annotation: amino acid-binding periplasmic (signal peptide) ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00497: SBP_bac_3" amino acids 38 to 263 (226 residues), 189.3 bits, see alignment E=7.2e-60 PF10613: Lig_chan-Glu_bd" amino acids 75 to 129 (55 residues), 33.5 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3244)

Predicted SEED Role

"amino acid ABC transporter, periplasmic amino acid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L38 at UniProt or InterPro

Protein Sequence (269 amino acids)

>SMc03864 amino acid-binding periplasmic (signal peptide) ABC transporter protein (Sinorhizobium meliloti 1021)
MTIRRHVLAGIAAVLAVPFAVSAPVFASDLPDLGGKTVVVVTENAYPPLQFVDPKSGQAI
GWEYDAMNEIAKRLNFKVEYQNTSWDAMIQAVSDGQYQIGMTGITIKDDRKEKVDFSDPY
MRSQQFMLVRGDETRFDDAKSFAALESGLVGAQPGTSPFYTAVYEVLDGNEQNPRIKLFE
TFGATVQALKAGDVDLVLTDSVAAKGYVDSSDGQLKVVGEPLGTEDFGFIFPKGSELVAP
VNAAIKALKEDGTFDALNKKWFLDYKMGG