Protein Info for SMc03860 in Sinorhizobium meliloti 1021

Annotation: 16S rRNA-processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR02273: 16S rRNA processing protein RimM" amino acids 8 to 166 (159 residues), 150.9 bits, see alignment E=1.1e-48 PF01782: RimM" amino acids 10 to 87 (78 residues), 77.7 bits, see alignment E=6.5e-26 PF05239: PRC" amino acids 96 to 168 (73 residues), 56.7 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 100% identical to RIMM_RHIME: Ribosome maturation factor RimM (rimM) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 98% identity to smd:Smed_3098)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L42 at UniProt or InterPro

Protein Sequence (187 amino acids)

>SMc03860 16S rRNA-processing protein RimM (Sinorhizobium meliloti 1021)
MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPAALGDYGNLHSEDGRVFEVLEIREAKNV
VVVRFRGINDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDRTGKSYGSV
TGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGK
PFPTKRK