Protein Info for SMc03849 in Sinorhizobium meliloti 1021

Annotation: heme exporter C (cytochrome C-type biogenesis protein) transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 19 to 189 (171 residues), 143.5 bits, see alignment E=3.8e-46 TIGR01191: heme exporter protein CcmC" amino acids 52 to 233 (182 residues), 279.6 bits, see alignment E=6e-88

Best Hits

Swiss-Prot: 73% identical to CCMC_BRADU: Heme exporter protein C (cycZ) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to sme:SMc03849)

MetaCyc: 49% identical to cytochrome c maturation protein C (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L53 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SMc03849 heme exporter C (cytochrome C-type biogenesis protein) transmembrane (Sinorhizobium meliloti 1021)
MSESSLAIRKFSDLANPTRFLALTDRVLPWLAALTLLVFAAGLWLSFTTEGDYQQGETVR
IMYVHVPSAWLSMMCYTVMAISALGTLVWRHPLADVSARAAAPIGACFTFLALVTGSLWG
KPMWGTWWVWDARLTSVFVLFLMYLGLIALNRAMDDPSRSARVSAVLILVGFVNIPIIKF
SVEWWNTLHQPASVIRLDGPTIDPEFLRPLIVMAIAFTLLFFTLHIAAMRNEIWRRRVAS
LRRQAARNAGREQLTP