Protein Info for SMc03840 in Sinorhizobium meliloti 1021

Annotation: acetyltransferase (antibiotic resistance) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF13302: Acetyltransf_3" amino acids 4 to 140 (137 residues), 36 bits, see alignment E=2.8e-12 PF13420: Acetyltransf_4" amino acids 8 to 158 (151 residues), 48.9 bits, see alignment E=1.9e-16 PF00583: Acetyltransf_1" amino acids 38 to 139 (102 residues), 52.5 bits, see alignment E=1.4e-17 PF13673: Acetyltransf_10" amino acids 51 to 143 (93 residues), 27.3 bits, see alignment E=7.9e-10 PF13508: Acetyltransf_7" amino acids 54 to 140 (87 residues), 37.7 bits, see alignment E=5.4e-13

Best Hits

Swiss-Prot: 46% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to smk:Sinme_3220)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L60 at UniProt or InterPro

Protein Sequence (185 amino acids)

>SMc03840 acetyltransferase (antibiotic resistance) protein (Sinorhizobium meliloti 1021)
MTATLRDAVAADLRSITEIYRESVLNGVATYEETPPSEAEMALRFSTITGNGYPYVVALD
ERGAVIGYAYASAFRNRTAYRFLVEDSIYLSPEARGKGIGKALLSELVGRCTALGFRQMI
AVIGGAHPSSIALHRALGFELQGLMKATGFKHGRWLDTAFMQRPLGEGTATKPTEGVYPD
TLYRS