Protein Info for SMc03831 in Sinorhizobium meliloti 1021
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RLMN_RHIME: Dual-specificity RNA methyltransferase RlmN (rlmN) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 100% identity to sme:SMc03831)Predicted SEED Role
"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92L68 at UniProt or InterPro
Protein Sequence (411 amino acids)
>SMc03831 hypothetical protein (Sinorhizobium meliloti 1021) MAATEILNRADIVKAPQVRLAPQPEKPSLIGLLRDDIAKLLAEKGVPERQVKMRVSQLWH WLYVRGVSDFDEMSNVSKDMREMLKEHFTIARPDIVEEQVSGDGTRKWLLRFPPRGAGRP VEIETVYIPEEGRGTLCISSQVGCTLTCSFCHTGTQKLVRNLTAEEILSQLLLARDRLGD FPERDTPQGAIVPAEGRKITNIVMMGMGEPLYNFENVKTALLIASDGDGLSLSKRRITLS TSGIVPEIYRTGEEIGVMLAISLHAVRDDLRDMLVPINKKYPLKQLMEACRAYPGLSNAR RITFEYVMLKDVNDSLEDAKELVKLLKGIPAKINLIPFNPWPGTNYQCSDWEQIEKFADF INQAGYASPIRTPRGRDILAACGQLKSESERMRKVDRLAFEAMMIANHGED