Protein Info for SMc03829 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 256 (244 residues), 93.3 bits, see alignment E=7.5e-31

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 100% identity to sme:SMc03829)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L70 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SMc03829 ABC transporter permease (Sinorhizobium meliloti 1021)
MSQIAFWGAVELGLVYAFVAVGVFLAFRVLDFPDLTVDGSFPLGAAVTAVLIIAGVNPWL
AAAVAMVAGAAAGMVTALLNVRFKILNLLASILTMIALFSVNLRVMGKPNVALINADTML
SPFYGLGLRDFYVRPLFVGILVAFAVVLVWRFLESDAGLAMRATGANARMARAQGVDTSR
QIYLGMAISNALVALGGALFAQTNGFADVTSGVGTIVVGLAAVIIGETLLGARGILIALI
GCVLGSILYRIAIQVALSTDTLGLQASDLNFVTALLVTIALILPRLRRGGAA