Protein Info for SMc03826 in Sinorhizobium meliloti 1021

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 9 to 401 (393 residues), 469.6 bits, E=5e-145
• PF00764: Arginosuc_synth
  • amino acids 9 to 170 (162 residues), 223.8 bits, E=2e-70
• PF00733: Asn_synthase
  • amino acids 14 to 75 (62 residues), 21.3 bits, E=2.9e-08
• PF20979: Arginosuc_syn_C
  • amino acids 181 to 398 (218 residues), 261.8 bits, E=7.3e-82

Best Hits

Swiss-Prot: 100% identical to ASSY_RHIME: Argininosuccinate synthase (argG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to smk:Sinme_3206)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See Q92L73 at UniProt or InterPro

Protein Sequence (405 amino acids)

>SMc03826 argininosuccinate synthase (Sinorhizobium meliloti 1021)
MASHKDVKKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQGEELEPARKKAEMLGI
KEIYIEDVREEFVRDFVFPMFRANAVYEGVYLLGTSIARPLISKHLIDIARKTGADAIAH
GATGKGNDQVRFELSAYALNPDIKIIAPWRDWSFKSRTDLLEFAEKHQIPVAKDKKGEAP
FSVDANLLHSSSEGKVLEDPAREAPEYVHMRTISPEAAPDKATVIKVGFERGDAVSIDGV
RMSPATLLAKLNEYGRDNGIGRLDLVENRFVGMKSRGVYETPGGTILLAAHRAIESITLD
RGAAHLKDELMPRYAELIYYGFWFSPEREMLQAAIDRSQEHVEGEVTLKLYKGNVMVIGR
ESGKSLYSDKLVTFEDDQGAYDQKDAAGFIKLNALRLRTLAARNR