Protein Info for SMc03801 in Sinorhizobium meliloti 1021

Annotation: thioredoxin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00085: Thioredoxin" amino acids 44 to 144 (101 residues), 91 bits, see alignment E=9.2e-30 TIGR01068: thioredoxin" amino acids 57 to 145 (89 residues), 103.9 bits, see alignment E=2.2e-34 PF13098: Thioredoxin_2" amino acids 58 to 141 (84 residues), 32.6 bits, see alignment E=1.8e-11 PF14559: TPR_19" amino acids 168 to 232 (65 residues), 52 bits, see alignment E=1.4e-17 PF14561: TPR_20" amino acids 241 to 329 (89 residues), 99.2 bits, see alignment E=2.7e-32

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to sme:SMc03801)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92L96 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SMc03801 thioredoxin protein (Sinorhizobium meliloti 1021)
MSGSDNPYQGSFGTQMTGSASFGGQPASAASGPNDLTPDDLIRETTTAAFTRDVLEASRQ
QPVLVDFWAPWCGPCKQLTPVIEKVVREAAGRVKLVKMNIDDHPSIAGQLGIQSIPAVIA
FIDGRPVDGFMGAVPESQIKEFIDRIAGPAADNGKAEIESVLADAKALIDAGDAQNAAGL
YGAVLQADPENAAAVAGMIECMIALGQVAEARQALSGLPEALAGEAAVAAVSKKLDQIEE
ARKLGDPAALERQLALDPDDHAARLKLAKLRNVEGDRTAAAEHLLTIMKRDRSFEDDGAR
RELLSFFEVWGPKDPATIAARRKLSSILFS